PDB entry 1pkp

View 1pkp on RCSB PDB site
Description:
Deposited on 1993-08-30, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1pkp_1, d1pkp_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1pkp_ (-)
    mrrinpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeai
    rkaiedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagi
    sdilsksigsntpinmvratfdglkqlkra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkp_ (-)
    inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
    iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
    lsksigsntpinmvratfdglkqlk