PDB entry 1pkp

View 1pkp on RCSB PDB site
Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna
Deposited on 1993-08-30, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pkp_ (-)
    inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
    iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
    lsksigsntpinmvratfdglkqlk