PDB entry 1pkn

View 1pkn on RCSB PDB site
Description: structure of rabbit muscle pyruvate kinase complexed with mn2+, k+, and pyruvate
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-03-25, released 1995-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.191
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • conflict (148-149)
      • conflict (167)
      • conflict (232-233)
      • conflict (498)
    Domains in SCOPe 2.05: d1pkna1, d1pkna2, d1pkna3
  • Heterogens: K, MN, PYR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pknA (A:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymaacdenilwldyknickvvevgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgvdedvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkaagffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pknA (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgselkkg
    atlkitldnaymaacdenilwldyknickvvevgskvyvddglislqvkqkgpdflvtev
    enggflgskkgvnlpgaavdlpavsekdiqdlkfgvdedvdmvfasfirkaadvhevrki
    lgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrc
    nragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrm
    qhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivltesgrs
    ahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvg
    kaagffkkgdvvivltgwrpgsgftntmrvvpvp