PDB entry 1pkn

View 1pkn on RCSB PDB site
Description: structure of rabbit muscle pyruvate kinase complexed with mn2+, k+, and pyruvate
Deposited on 1994-03-25, released 1995-01-26
The last revision prior to the SCOP 1.57 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.9 Å
R-factor: 0.191
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1pkn_ (-)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymaacdenilwldyknickvvevgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgvdedvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkaagffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkn_ (-)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgselkkg
    atlkitldnaymaacdenilwldyknickvvevgskvyvddglislqvkqkgpdflvtev
    enggflgskkgvnlpgaavdlpavsekdiqdlkfgvdedvdmvfasfirkaadvhevrki
    lgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkmiigrc
    nragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypleavrm
    qhliareaeaamfhrklfeelarssshstdlmeamamgsveasykclaaalivltesgrs
    ahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvg
    kaagffkkgdvvivltgwrpgsgftntmrvvpvp