PDB entry 1pkm

View 1pkm on RCSB PDB site
Description: the refined three-dimensional structure of cat muscle (m1) pyruvate kinase, at a resolution of 2.6 angstroms
Class: kinase
Keywords: pyruvate kinase, kinase
Deposited on 1995-07-13, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m1 pyruvate kinase
    Species: Felis catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pkma1, d1pkma2, d1pkma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkmA (A:)
    skphsdvgtafiqtqqlhaamadtflehmcrldidsppitarntgiictigpasrsveil
    kemiksgmnvarlnfshgtheyhaetiknvraatesfasdpiryrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenvlwldyknickvvevgskvyvddgli
    sllvkekgadflvtevenggslgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkasdvhevrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmmigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelvrgsshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkhgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkmA (A:)
    iqtqqlhaamadtflehmcrldidsppitarntgiictigpasrsveilkemiksgmnva
    rlnfshgtheyhaetiknvraatesfasdpiryrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenvlwldyknickvvevgskvyvddglisllvkekgadf
    lvtevenggslgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkasdvh
    evrkvlgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    migrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelvrgsshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkhgdvvivltgwrpgsgftntmrvvpvp