PDB entry 1pkl

View 1pkl on RCSB PDB site
Description: the structure of leishmania pyruvate kinase
Class: transferase
Keywords: pyruvate kinase, glycolytic enzyme, homotetramer, transferase
Deposited on 1998-09-15, released 1998-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pkla1, d1pkla2, d1pkla3
  • Chain 'B':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pklb1, d1pklb2, d1pklb3
  • Chain 'C':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pklc1, d1pklc2, d1pklc3
  • Chain 'D':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pkld1, d1pkld2, d1pkld3
  • Chain 'E':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pkle1, d1pkle2, d1pkle3
  • Chain 'F':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pklf1, d1pklf2, d1pklf3
  • Chain 'G':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pklg1, d1pklg2, d1pklg3
  • Chain 'H':
    Compound: protein (pyruvate kinase)
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • conflict (382)
      • conflict (389)
      • conflict (404-405)
    Domains in SCOPe 2.06: d1pklh1, d1pklh2, d1pklh3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pklA (A:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklA (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    aanqtrillve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pklB (B:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklB (B:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvia
    nqtrillve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pklC (C:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklC (C:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adanqtrillve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pklD (D:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklD (D:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhanqtrillve
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pklE (E:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklE (E:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhanqtrillve
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pklF (F:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklF (F:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    aanqtrillve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pklG (G:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklG (G:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhkvkgyanqtrillve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pklH (H:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pklH (H:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adanqtrillve