PDB entry 1pkk

View 1pkk on RCSB PDB site
Description: Structural basis for recognition and catalysis by the bifunctional dCTP deaminase and dUTPase from Methanococcus jannaschii
Class: hydrolase
Keywords: dctp deaminase, dutpase, dcd-dut, mj0430, dctp, dutp, hydrolase
Deposited on 2003-06-05, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional deaminase/diphosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pkka_
  • Chain 'B':
    Compound: bifunctional deaminase/diphosphatase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pkkb_
  • Heterogens: DCP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkkA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkkA (A:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    kt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkkB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgyser
    ktskyayqksvmpslihldnhkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkkB (B:)
    milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
    iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
    grvfltshqtagwidagfkgkitleivafdkpvilyknqrigqlifskllspadvgy