PDB entry 1pkg

View 1pkg on RCSB PDB site
Description: Structure of a c-Kit Kinase Product Complex
Class: transferase activator
Keywords: kinase, autophosphorylation, transactivation, TRANSFERASE ACTIVATOR
Deposited on 2003-06-05, released 2003-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-kit protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721
      • modified residue (19)
      • modified residue (21)
    • PDB 1PKG
    Domains in SCOPe 2.06: d1pkga_
  • Chain 'B':
    Compound: c-kit protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721
      • modified residue (19)
      • modified residue (21)
    • PDB 1PKG
    Domains in SCOPe 2.06: d1pkgb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pkgA (A:)
    qkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveata
    ygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgactiggptlv
    iteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakgmaflask
    ncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmapesifncvy
    tfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaemydimktc
    wdadplkrptfkqivqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkgA (A:)
    nyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkmlk
    psahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrkr
    dsficskaldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglar
    dikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpv
    dskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pkgB (B:)
    qkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveata
    ygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgactiggptlv
    iteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakgmaflask
    ncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmapesifncvy
    tfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaemydimktc
    wdadplkrptfkqivqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pkgB (B:)
    nnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkml
    kpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrk
    rdsficldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglardr
    lpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrml
    spehapaemydimktcwdadplkrptfkqivqliekqis