PDB entry 1pk8

View 1pk8 on RCSB PDB site
Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP
Class: membrane protein
Keywords: ATP binding, ATP grasp, calcium (II) ion, MEMBRANE PROTEIN
Deposited on 2003-06-05, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8a1, d1pk8a2
  • Chain 'B':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8b1, d1pk8b2
  • Chain 'C':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8c1, d1pk8c2
  • Chain 'D':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8d1, d1pk8d2
  • Chain 'E':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8e1, d1pk8e2
  • Chain 'F':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8f1, d1pk8f2
  • Chain 'G':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8g1, d1pk8g2
  • Chain 'H':
    Compound: rat synapsin I
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk8h1, d1pk8h2
  • Heterogens: CA, ATP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pk8A (A:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8A (A:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
    vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaq
    mvrlhkklgteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdi
    asvvaltktyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsd
    ryklwvdtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvv
    nkmtqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pk8B (B:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8B (B:)
    arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslkp
    dfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkklg
    teefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltkt
    yataepfidakydvrvqkigqnykaymrtwktntgsamleqiamsdryklwvdtcseifg
    gldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pk8C (C:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8C (C:)
    arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslkp
    dfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkklg
    teefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltkt
    yataepfidakydvrvqkigqnykaymrtwkleqiamsdryklwvdtcseifggldicav
    ealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pk8D (D:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8D (D:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevvvrs
    lkpdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhk
    klgteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvval
    tktyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwv
    dtcseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pk8E (E:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8E (E:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtwktleqiamsdryklwvdtcseifggldic
    avealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pk8F (F:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8F (F:)
    arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslkp
    dfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkklg
    teefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltkt
    yataepfidakydvrvqkigqnykaymrtwktleqiamsdryklwvdtcseifggldica
    vealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pk8G (G:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8G (G:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvnwktnamleqiamsdryklwvdtcseif
    ggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pk8H (H:)
    gsnylrrrlsdsnfmanlpngymtdlqrpqppppppsaaspgatpgsaaasaerastaap
    vaspaapspgssggggffsslsnavkqttaaaaatfseqvgggsggagrggaaarvllvi
    dephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngvkvvrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtsvsgnwktntgsamleqiamsdryklwvdt
    cseifggldicavealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqalp
    rq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk8H (H:)
    aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslk
    pdfvlirqhafsmarngdyrslviglqyagipsvnslhsvynfcdkpwvfaqmvrlhkkl
    gteefplidqtfypnhkemlssttypvvvkmghahsgmgkvkvdnqhdfqdiasvvaltk
    tyataepfidakydvrvqkigqnykaymrtwkleqiamsdryklwvdtcseifggldica
    vealhgkdgrdhiievvgssmpligdhqdedkqlivelvvnkmtqa