PDB entry 1pk6

View 1pk6 on RCSB PDB site
Description: Globular Head of the Complement System Protein C1q
Class: immune system
Keywords: Complement system, C1q, immunology, jellyroll, IgG, IMMUNE SYSTEM
Deposited on 2003-06-05, released 2003-10-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.201
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q subcomponent, A chain precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pk6a_
  • Chain 'B':
    Compound: Complement C1q subcomponent, B chain precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pk6b_
  • Chain 'C':
    Compound: Complement C1q subcomponent, C chain precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pk6c_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pk6A (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pk6B (B:)
    tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
    nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
    nsifsgfllfpd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pk6C (C:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd