PDB entry 1pk5

View 1pk5 on RCSB PDB site
Description: Crystal structure of the orphan nuclear receptor LRH-1
Class: gene regulation
Keywords: nuclear receptor, ligand-binding domain, LRH-1, GENE REGULATION
Deposited on 2003-06-04, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orphan nuclear receptor NR5A2
    Species: Mus musculus [TaxId:10090]
    Gene: NR5A2 OR LRH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45448 (5-End)
      • see remark 999 (212)
    Domains in SCOPe 2.07: d1pk5a_
  • Chain 'B':
    Compound: Orphan nuclear receptor NR5A2
    Species: Mus musculus [TaxId:10090]
    Gene: NR5A2 OR LRH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45448
      • see remark 999 (212)
    Domains in SCOPe 2.07: d1pk5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pk5A (A:)
    qtnspasiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtl
    fsivewarssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdy
    stiishtevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegv
    qeqvnaalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlli
    emlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk5A (A:)
    asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
    warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
    htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
    aalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlha
    kr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pk5B (B:)
    qtnspasiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtl
    fsivewarssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdy
    stiishtevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegv
    qeqvnaalldytvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlli
    emlhakra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk5B (B:)
    siphlilellkcepdepqvqakimaylqqeqsnrlsafgllckmadqtlfsivewarssi
    ffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiishtevaf
    nnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvnaalldy
    tvcnypqqtekfgqlllrlpelraiskqaedylyykhvngdvpynnlliemlhakr