PDB entry 1pk3

View 1pk3 on RCSB PDB site
Description: Scm SAM domain
Class: transcription repression
Keywords: SAM domain, polymer, transcriptional repression
Deposited on 2003-06-04, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-End)
      • cloning artifact (4)
      • engineered (51)
    Domains in SCOP 1.75: d1pk3a1
  • Chain 'B':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0
      • engineered (51)
    Domains in SCOP 1.75: d1pk3b1
  • Chain 'C':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-End)
      • cloning artifact (2-4)
      • engineered (51)
    Domains in SCOP 1.75: d1pk3c1
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pk3A (A:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3A (A:)
    ranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymgl
    klgpalkicnlvnkvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pk3B (B:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3B (B:)
    qpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalki
    cnlvnkvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pk3C (C:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3C (C:)
    ktranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkym
    glklgpalkicnlvnkvn