PDB entry 1pk3

View 1pk3 on RCSB PDB site
Description: Scm SAM domain
Class: transcription repression
Keywords: SAM domain, polymer, transcriptional repression, transcription repression
Deposited on 2003-06-04, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-End)
      • cloning artifact (4)
      • engineered (51)
    Domains in SCOPe 2.07: d1pk3a1, d1pk3a2
  • Chain 'B':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0
      • engineered (51)
    Domains in SCOPe 2.07: d1pk3b_
  • Chain 'C':
    Compound: Sex comb on midleg CG9495-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Scm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VHA0 (5-End)
      • cloning artifact (2-4)
      • engineered (51)
    Domains in SCOPe 2.07: d1pk3c2, d1pk3c3
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pk3A (A:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3A (A:)
    ranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymgl
    klgpalkicnlvnkvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pk3B (B:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3B (B:)
    qpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalki
    cnlvnkvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pk3C (C:)
    mektranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmk
    ymglklgpalkicnlvnkvngrdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pk3C (C:)
    ktranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkym
    glklgpalkicnlvnkvn