PDB entry 1pk2

View 1pk2 on RCSB PDB site
Description: solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug
Class: plasminogen activator
Keywords: plasminogen activator
Deposited on 1991-09-16, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tissue-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pk2a_
  • Heterogens: ACA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pk2A (A:)
    segnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycr
    npdgdakpwchvlknrrltweycdvpscst