PDB entry 1pjz

View 1pjz on RCSB PDB site
Description: Solution structure of thiopurine methyltransferase from Pseudomonas syringae
Class: transferase
Keywords: methyltransferase, polymorphism, S-adenosylmethionine, drug metabolism
Deposited on 2003-06-04, released 2003-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiopurine s-methyltransferase
    Species: Pseudomonas syringae pv. pisi [TaxId:59510]
    Gene: TPM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pjza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pjzA (A:)
    gshqsevnkdlqqywsslnvvpgarvlvplcgksqdmswlsgqgyhvvgaelseaavery
    ftergeqphitsqgdfkvyaapgieiwcgdffaltardighcaafydraamialpadmre
    ryvqhlealmpqacsgllitleydqallegppfsvpqtwlhrvmsgnwevtkvggqdtlh
    ssarglkaglermdehvyvlerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjzA (A:)
    hqsevnkdlqqywsslnvvpgarvlvplcgksqdmswlsgqgyhvvgaelseaaveryft
    ergeqphitsqgdfkvyaapgieiwcgdffaltardighcaafydraamialpadmrery
    vqhlealmpqacsgllitleydqallegppfsvpqtwlhrvmsgnwevtkvggqdtlhss
    arglkaglermdehvyvlerv