PDB entry 1pjw

View 1pjw on RCSB PDB site
Description: Solution Structure of the Domain III of the Japan Encephalitis Virus Envelope Protein
Class: Viral protein
Keywords: flavivirus, JEV, E protein, structure, NMR, epitope mapping, Viral protein
Deposited on 2003-06-04, released 2003-11-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope protein
    Species: Japanese encephalitis virus [TaxId:11072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pjwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjwA (A:)
    dklalkgttygmctekfsfaknpadtghgtvvielsysgsdgpckipivsvaslndmtpv
    grlvtvnpfvatssanskvlvemeppfgdsyivvgmgdkqinhhwhkagst