PDB entry 1pjp

View 1pjp on RCSB PDB site
Description: the 2.2 a crystal structure of human chymase in complex with succinyl-ala-ala-pro-phe-chloromethylketone
Class: hydrolase/hydrolase inhibitor
Keywords: human chymase, serine proteinase, dipeptidyl carboxypeptidase, angiotensin, hydrolase-hydrolase inhibitor complex
Deposited on 1998-09-07, released 1999-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23946 (0-225)
      • engineered (113)
      • engineered (190)
      • engineered (215)
    Domains in SCOPe 2.08: d1pjpa_
  • Chain 'I':
    Compound: succinyl-ala-ala-pro-phe-chloromethylketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1PJP (Start-5)
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pjpA (A:)
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

  • Chain 'I':
    No sequence available.