PDB entry 1pjj

View 1pjj on RCSB PDB site
Description: Complex between the Lactococcus lactis Fpg and an abasic site containing DNA.
Class: hydrolase/DNA
Keywords: DNA repair, Fpg, MutM, abasic site
Deposited on 2003-06-03, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: subsp. cremoris
    Gene: MUTM or FPG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42371 (0-270)
      • engineered (0)
    Domains in SCOP 1.73: d1pjja1, d1pjja2, d1pjja3
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*cp*tp*tp*tp*(3dr)p*tp*tp*tp*cp*tp*cp*g)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3')
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pjjA (A:)
    gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.