PDB entry 1pji

View 1pji on RCSB PDB site
Description: Crystal structure of wild type Lactococcus lactis FPG complexed to a 1,3 propanediol containing DNA
Class: Hydrolase/DNA
Keywords: DNA repair, FPG, MutM, Abasic site
Deposited on 2003-06-03, released 2004-08-03
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Lactococcus lactis
    Gene: MUTM or FPG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pjia1, d1pjia2, d1pjia3
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*cp*tp*tp*tp*(pdi)p*tp*tp*tp*cp*tp*cp*g)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pjiA (A:)
    pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
    tgekcsrcgaeiqkikvagrgthfcpvcqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjiA (A:)
    pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
    qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpeketnqliessihllhdsiieilqkaiklggsssalgstgkmqnelqvygktgek
    csrcgaeiqkikvagrgthfcpvcqqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.