PDB entry 1pjh

View 1pjh on RCSB PDB site
Description: structural studies on delta3-delta2-enoyl-coa isomerase: the variable mode of assembly of the trimeric disks of the crotonase superfamily
Deposited on 2003-06-03, released 2004-01-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pjha_
  • Chain 'B':
    Domains in SCOP 1.67: d1pjhb_
  • Chain 'C':
    Domains in SCOP 1.67: d1pjhc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pjhA (A:)
    msqeirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiq
    ssgrffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvliccln
    gpaiglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmf
    nkpfkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnh
    idafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjhA (A:)
    irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
    ffssgadfkgiakkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalv
    alcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimce
    ngfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansve
    vneslkywvdgeplkrfrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pjhB (B:)
    msqeirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiq
    ssgrffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvliccln
    gpaiglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmf
    nkpfkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnh
    idafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjhB (B:)
    eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
    rffssgadfkgiakkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaal
    valcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimc
    engfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansv
    evneslkywvdgeplkrfrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pjhC (C:)
    msqeirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiq
    ssgrffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvliccln
    gpaiglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmf
    nkpfkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnh
    idafnkansvevneslkywvdgeplkrfrqlgskqrkhrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjhC (C:)
    irqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgr
    ffssgadfkgiaypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
    cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
    fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
    eslkywvdgeplkrfrq