PDB entry 1pja

View 1pja on RCSB PDB site
Description: the crystal structure of palmitoyl protein thioesterase-2 reveals the basis for divergent substrate specificities of the two lysosomal thioesterases (ppt1 and ppt2)
Deposited on 2003-06-02, released 2003-09-02
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pjaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pjaA (A:)
    mlglwgqrlpaawvllllpflpllllaapaphrasykpvivvhglfdssysfrhlleyin
    ethpgtvvtvldlfdgreslrplweqvqgfreavvpimakapqgvhlicysqgglvcral
    lsvmddhnvdsfislsspqmgqygdtdylkwlfptsmrsnlyricyspwgqefsicnywh
    dphhddlylnassflalingerdhpnatvwrknflrvghlvliggpddgvitpwqssffg
    fydanetvlemeeqlvylrdsfglktllargaivrcpmagishtawhsnrtlyetciepw
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pjaA (A:)
    sykpvivvhglfdssysfrhlleyinethpgtvvtvldlfdgreslrplweqvqgfreav
    vpimakapqgvhlicysqgglvcrallsvmddhnvdsfislsspqmgqygdtdylkwlfp
    tsmrsnlyricyspwgqefsicnywhdphhddlylnassflalingerdhpnatvwrknf
    lrvghlvliggpddgvitpwqssffgfydanetvlemeeqlvylrdsfglktllargaiv
    rcpmagishtawhsnrtlyetciepwls