PDB entry 1pj6

View 1pj6 on RCSB PDB site
Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with folic acid
Class: oxidoreductase
Keywords: channelling, folate binding, FAD binding, amine oxidation, OXIDOREDUCTASE
Deposited on 2003-06-01, released 2003-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N,N-dimethylglycine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pj6a1, d1pj6a2, d1pj6a3, d1pj6a4
  • Heterogens: NA, FOL, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pj6A (A:)
    mastpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsk
    tmasfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrlls
    paecqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqs
    ggrvtgvqtadgvipadivvscagfwgakigamigmavpllplahqyvkttpvpaqqgrn
    dqpngarlpilrhqdqdlyyrehgdrygigsyahrpmpvdvdtlgayapetvsehhmpsr
    ldftledflpaweatkqllpaladseiedgfngifsftpdggpllgeskeldgfyvaeav
    wvthsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhp
    lqprlsprnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardaw
    sgmfsspiaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtyt
    llldhaggvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttg
    gtcciglwgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwely
    tsadngqrlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfa
    vkmakesfigkgalegrteeasarrlrcltiddgrsivlgkepvfykeqavgyvtsaayg
    ytvakpiaysylpgtvsvgdsvdieyfgrritatvtedplydpkmtrlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj6A (A:)
    stpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsktm
    asfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrllspa
    ecqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqsgg
    rvtgvqtadgvipadivvscagfwgakigamigmavpllplahqyvkttpvpaqqgrndq
    pngarlpilrhqdqdlyyrehgdrygigsyahrpmpvdvdtlgayapetvsehhmpsrld
    ftledflpaweatkqllpaladseiedgfngifsftpdggpllgeskeldgfyvaeavwv
    thsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhplq
    prlsprnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardawsg
    mfsspiaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtytll
    ldhaggvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttggt
    cciglwgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwelyts
    adngqrlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfavk
    makesfigkgalegrteeasarrlrcltiddgrsivlgkepvfykeqavgyvtsaaygyt
    vakpiaysylpgtvsvgdsvdieyfgrritatvtedplydpkmtrlrg