PDB entry 1pj6

View 1pj6 on RCSB PDB site
Description:
Deposited on 2003-06-01, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pj6A (A:)
    mastpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsk
    tmasfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrlls
    paecqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqs
    ggrvtgvqtadgvipadivvscagfwgakigamigmavpllplahqyvkttpvpaqqgrn
    dqpngarlpilrhqdqdlyyrehgdrygigsyahrpmpvdvdtlgayapetvsehhmpsr
    ldftledflpaweatkqllpaladseiedgfngifsftpdggpllgeskeldgfyvaeav
    wvthsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhp
    lqprlsprnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardaw
    sgmfsspiaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtyt
    llldhaggvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttg
    gtcciglwgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwely
    tsadngqrlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfa
    vkmakesfigkgalegrteeasarrlrcltiddgrsivlgkepvfykeqavgyvtsaayg
    ytvakpiaysylpgtvsvgdsvdieyfgrritatvtedplydpkmtrlrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj6A (A:)
    stpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsktm
    asfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrllspa
    ecqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqsgg
    rvtgvqtadgvipadivvscagfwgakigamigmavpllplahqyvkttpvpaqqgrndq
    pngarlpilrhqdqdlyyrehgdrygigsyahrpmpvdvdtlgayapetvsehhmpsrld
    ftledflpaweatkqllpaladseiedgfngifsftpdggpllgeskeldgfyvaeavwv
    thsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhplq
    prlsprnlrvspfharhkelgaffleaggwerpywfeanaallkempaewlppardawsg
    mfsspiaaaeawktrtavamydmtplkrlevsgpgalkllqelttadlakkpgavtytll
    ldhaggvrsditvarlsedtfqlgangnidtayferaarhqtqsgsatdwvqvrdttggt
    cciglwgplardlvskvsdddftndglkyfraknvviggipvtamrlsyvgelgwelyts
    adngqrlwdalwqagqpfgviaagraafsslrlekgyrswgtdmttehdpfeaglgfavk
    makesfigkgalegrteeasarrlrcltiddgrsivlgkepvfykeqavgyvtsaaygyt
    vakpiaysylpgtvsvgdsvdieyfgrritatvtedplydpkmtrlrg