PDB entry 1pj2

View 1pj2 on RCSB PDB site
Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate malate, cofactor NADH, Mn++, and allosteric activator fumarate
Class: oxidoreductase
Keywords: oxidative decarboxylase, OXIDOREDUCTASE
Deposited on 2003-05-30, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent malic enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ME2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (8)
      • modified residue (17)
      • modified residue (26)
      • modified residue (54)
      • modified residue (65)
      • modified residue (87)
      • modified residue (156)
      • modified residue (198)
      • modified residue (218)
      • modified residue (304)
      • modified residue (306)
      • modified residue (322)
      • modified residue (386)
      • modified residue (518)
    Domains in SCOPe 2.06: d1pj2a1, d1pj2a2
  • Chain 'B':
    Compound: NAD-dependent malic enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ME2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (8)
      • modified residue (17)
      • modified residue (26)
      • modified residue (54)
      • modified residue (65)
      • modified residue (87)
      • modified residue (156)
      • modified residue (198)
      • modified residue (218)
      • modified residue (304)
      • modified residue (306)
      • modified residue (322)
      • modified residue (386)
      • modified residue (518)
    Domains in SCOPe 2.06: d1pj2b1, d1pj2b2
  • Chain 'C':
    Compound: NAD-dependent malic enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ME2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368
      • modified residue (8)
      • modified residue (17)
      • modified residue (26)
      • modified residue (54)
      • modified residue (65)
      • modified residue (87)
      • modified residue (156)
      • modified residue (198)
      • modified residue (218)
      • modified residue (304)
      • modified residue (306)
      • modified residue (322)
      • modified residue (386)
      • modified residue (518)
    Domains in SCOPe 2.06: d1pj2c1, d1pj2c2
  • Chain 'D':
    Compound: NAD-dependent malic enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ME2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368 (0-End)
      • modified residue (8)
      • modified residue (17)
      • modified residue (26)
      • modified residue (54)
      • modified residue (65)
      • modified residue (87)
      • modified residue (156)
      • modified residue (198)
      • modified residue (218)
      • modified residue (304)
      • modified residue (306)
      • modified residue (322)
      • modified residue (386)
      • modified residue (518)
    Domains in SCOPe 2.06: d1pj2d1, d1pj2d2
  • Heterogens: MLT, MN, NAI, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pj2A (A:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj2A (A:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pj2B (B:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj2B (B:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pj2C (C:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj2C (C:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pj2D (D:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewpesassppvite
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pj2D (D:)
    ikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsple
    kyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdr
    ghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclp
    vcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnh
    nafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgia
    nlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfeda
    vnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegr
    clfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalts
    qltdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrs
    eydsllpdvyewp