PDB entry 1pix

View 1pix on RCSB PDB site
Description: Crystal structure of the carboxyltransferase subunit of the bacterial ion pump glutaconyl-coenzyme A decarboxylase
Class: lyase
Keywords: decarboxylase, biotin-dependent ion pump, carboxyltransferase, LYASE
Deposited on 2003-05-30, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaconyl-CoA decarboxylase A subunit
    Species: Acidaminococcus fermentans [TaxId:905]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pixa2, d1pixa3
  • Chain 'B':
    Compound: Glutaconyl-CoA decarboxylase A subunit
    Species: Acidaminococcus fermentans [TaxId:905]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pixb2, d1pixb3
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pixA (A:)
    mgfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrge
    ltalqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklaga
    wvpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnql
    gipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneia
    dmvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpkydpeffrvddpk
    apafpaddlysmvplndkraydiynviarlfdnselheykkgygpemvtglakvngllvg
    vvanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlpivwiqdttgidv
    gndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqgndtnafsigtaa
    teiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytksrpkvcaelglvd
    eivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pixA (A:)
    gfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrgel
    talqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklagaw
    vpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnqlg
    ipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneiad
    mvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpkydpeffrvddpka
    pafpaddlysmvplndkraydiynviarlfdnselheykkgygpemvtglakvngllvgv
    vanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlpivwiqdttgidvg
    ndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqgndtnafsigtaat
    eiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytksrpkvcaelglvde
    ivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pixB (B:)
    mgfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrge
    ltalqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklaga
    wvpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnql
    gipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneia
    dmvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpkydpeffrvddpk
    apafpaddlysmvplndkraydiynviarlfdnselheykkgygpemvtglakvngllvg
    vvanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlpivwiqdttgidv
    gndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqgndtnafsigtaa
    teiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytksrpkvcaelglvd
    eivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pixB (B:)
    gfysmpryfqnmpqvgkplkkadaaneeqlkkieeeihqlikeaqeagkadadvnkrgel
    talqrieklvepgswrplntlfnpqgnkngsvaivkglgrvngkwcvvvasdnkklagaw
    vpgqaecllrasdtaktlhvplvyvlncsgvkfdeqekvypnrrgggtpffrnaelnqlg
    ipvivgiygtnpagggyhsisptviiahekanmavggagimggmnpkghvdleyaneiad
    mvdrtgkteppgavdihytetgfmrevyaseegvlegikkyvgmlpkydpeffrvddpka
    pafpaddlysmvplndkraydiynviarlfdnselheykkgygpemvtglakvngllvgv
    vanvqgllmnypeykaagsvgiggklyrqglvkmnefvtlcardrlpivwiqdttgidvg
    ndaekaellglgqsliysiqtshipqfeitlrkgtaaahyvlggpqgndtnafsigtaat
    eiavmngetaatamysrrlakdrkagkdlqptidkmnnliqafytksrpkvcaelglvde
    ivdmnkirgyveafteaayqnpesicpfhqmilprairefetfvkk