PDB entry 1piw

View 1piw on RCSB PDB site
Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Class: oxidoreductase
Keywords: adh topology, nadp(h)dependent, oxidoreductase
Deposited on 2003-05-30, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR318C (ADH6)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1piwa1, d1piwa2
  • Chain 'B':
    Compound: Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR318C (ADH6)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1piwb1, d1piwb2
  • Heterogens: ZN, NAP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1piwA (A:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1piwB (B:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd