PDB entry 1piw

View 1piw on RCSB PDB site
Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Deposited on 2003-05-30, released 2004-08-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1piwA (A:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1piwB (B:)
    msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
    kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
    ysqpyedgyvsqggyanyvrvhehfvvpipenipshlaapllcggltvysplvrngcgpg
    kkvgivglggigsmgtliskamgaetyvisrssrkredamkmgadhyiatleegdwgeky
    fdtfdlivvcassltdidfnimpkamkvggrivsisipeqhemlslkpyglkavsisysa
    lgsikelnqllklvsekdikiwvetlpvgeagvheafermekgdvryrftlvgydkefsd