PDB entry 1piv

View 1piv on RCSB PDB site
Description: binding of the antiviral drug win51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14
Class: Virus
Keywords: VIRUS, Icosahedral virus
Deposited on 1995-02-02, released 1995-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.316
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: poliovirus type 3 (subunit vp1)
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PIV (0-3)
  • Chain '1':
    Compound: poliovirus type 3 (subunit vp1)
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1piv1_
  • Chain '2':
    Compound: poliovirus type 3 (subunit vp2)
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1piv.1
  • Chain '3':
    Compound: poliovirus type 3 (subunit vp3)
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1piv3_
  • Chain '4':
    Compound: poliovirus type 3 (subunit vp4)
    Species: Poliovirus type 3 (strains P3/LEON/37 AND P3/LEON 12A[1]B) [TaxId:12088]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1piv.1
  • Heterogens: MYR, W71

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1piv1 (1:)
    qgiedlisevaqgaltlslpkqqdslpdtkasgpahskevpaltavetgatnplapsdtv
    qtrhvvqrrsrsestiesffargacvaiievdneqpttraqklfamwritykdtvqlrrk
    lefftysrfdmeftfvvtanftnannghalnqvyqimyippgaptpkswddytwqtssnp
    sifytygaaparisvpyvglanayshfydgfakvplktdandqigdslysamtvddfgvl
    avrvvndhnptkvtskvriymkpkhvrvwcprppravpyygpgvdyrnnldplsekgltt
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1piv1 (1:)
    qdslpdtkasgpahskevpaltavetgatnplapsdtvqtrhvvqrrsrsestiesffar
    gacvaiievdneqpttraqklfamwritykdtvqlrrklefftysrfdmeftfvvtanft
    nannghalnqvyqimyippgaptpkswddytwqtssnpsifytygaaparisvpyvglan
    ayshfydgfakvplktdandqigdslysamtvddfgvlavrvvndhnptkvtskvriymk
    pkhvrvwcprppravpyygpgvdyrnnldplsekgltty
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1piv2 (2:)
    spnveacgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvat
    crfytldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqg
    algvfaipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyll
    gcgvllgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaq
    dssveipitvtiapmcsefnglrnvtapkfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1piv2 (2:)
    acgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvatcrfyt
    ldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
    aipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyllgcgvl
    lgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaqdssve
    ipitvtiapmcsefnglrnvtapkfq
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1piv3 (3:)
    glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
    krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
    cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
    qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsalpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1piv3 (3:)
    glpvlntpgsnqyltsdnhqspcaipefdvtppidipgevknmmelaeidtmiplnlest
    krntmdmyrvtlsdsadlsqpilclslspafdprlshtmlgevlnyythwagslkftflf
    cgsmmatgkilvayappgaqpptsrkeamlgthviwdlglqssctmvvpwisnvtyrqtt
    qdsfteggyismfyqtrivvplstpksmsmlgfvsacndfsvrllrdtthisqsa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1piv4 (4:)
    gaqvssqkvgahensnrayggstinyttinyykdsasnaaskqdysqdpskfteplkdvl
    iktapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1piv4 (4:)
    gaqvssqkvgahensstinyttinyykdsasnaaskqdysqdpskfteplkdvliktapa
    ln