PDB entry 1pip

View 1pip on RCSB PDB site
Description: crystal structure of papain-succinyl-gln-val-val-ala-ala-p-nitroanilide complex at 1.7 angstroms resolution: noncovalent binding mode of a common sequence of endogenous thiol protease inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: thiol protease, hydrolase-hydrolase inhibitor complex
Deposited on 1992-10-03, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.08: d1pipa_
  • Chain 'B':
    Compound: succinyl-gln-val-val-ala-ala-p-nitroanilide
    Database cross-references and differences (RAF-indexed):
    • PDB 1PIP (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pipA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn
    

  • Chain 'B':
    No sequence available.