PDB entry 1pio

View 1pio on RCSB PDB site
Description: an engineered staphylococcus aureus pc1 beta-lactamase that hydrolyses third generation cephalosporins
Class: hydrolase (acting on cyclic amides)
Keywords: hydrolase (acting on cyclic amides)
Deposited on 1995-10-11, released 1996-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.189
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-256)
      • engineered (205)
    Domains in SCOPe 2.05: d1pioa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: BLAZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00807 (1-256)
      • engineered (205)
    Domains in SCOPe 2.05: d1piob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pioA (A:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqstyasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pioA (A:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqstyasrndvafvypkgqsepivlviftnkdnksdkp
    ndklisetaksvmkef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pioB (B:)
    mkelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynkln
    kkvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrl
    kelgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlml
    nnksgdtlikdgvpkdykvadksgqstyasrndvafvypkgqsepivlviftnkdnksdk
    pndklisetaksvmkef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pioB (B:)
    kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
    kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
    elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
    nksgdtlikdgvpkdykvadksgqstyasrndvafvypkgqsepivlviftnkdnksdkp
    ndklisetaksvmkef