PDB entry 1pil

View 1pil on RCSB PDB site
Description: structure of the escherichia coli signal transducing protein pii
Class: nitrogen regulatory protein
Keywords: nitrogen regulatory protein
Deposited on 1994-08-04, released 1995-08-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: signal transducing protein p2
  Species: ESCHERICHIA COLI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A9Z1 (0-111)
  Domains in SCOP 1.75: d1pila_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pilA (A:)
  mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
  ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai