PDB entry 1pil

View 1pil on RCSB PDB site
Description: structure of the escherichia coli signal transducing protein pii
Deposited on 1994-08-04, released 1995-08-04
The last revision prior to the SCOP 1.71 freeze date was dated 1995-08-04, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1pil__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pil_ (-)
  mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
  ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai