PDB entry 1pii

View 1pii on RCSB PDB site
Description: three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution
Class: bifunctional(isomerase and synthase)
Keywords: bifunctional(isomerase and synthase)
Deposited on 1991-06-21, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-(5'phosphoribosyl)anthranilate isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1piia1, d1piia2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1piiA (A:)
    mqtvlakivadkaiwvearkqqqplasfqnevqpstrhfydalqgartafileckkasps
    kgvirddfdpariaaiykhyasaisvltdekyfqgsfnflpivsqiapqpilckdfiidp
    yqiylaryyqadacllmlsvldddqyrqlaavahslemgvltevsneeeqeraialgakv
    vginnrdlrdlsidlnrtrelapklghnvtvisesgintyaqvrelshfangfligsalm
    ahddlhaavrrvllgenkvcgltrgqdakaaydagaiygglifvatsprcvnveqaqevm
    aaaplqyvgvfrnhdiadvvdkakvlslaavqlhgneeqlyidtlrealpahvaiwkals
    vgetlparefqhvdkyvldngqggsgqrfdwsllngqslgnvllagglgadncveaaqtg
    cagldfnsavesqpgikdarllasvfqtlray