PDB entry 1pii

View 1pii on RCSB PDB site
Description: three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution
Deposited on 1991-06-21, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pii_ (-)
    mqtvlakivadkaiwvearkqqqplasfqnevqpstrhfydalqgartafileckkasps
    kgvirddfdpariaaiykhyasaisvltdekyfqgsfnflpivsqiapqpilckdfiidp
    yqiylaryyqadacllmlsvldddqyrqlaavahslemgvltevsneeeqeraialgakv
    vginnrdlrdlsidlnrtrelapklghnvtvisesgintyaqvrelshfangfligsalm
    ahddlhaavrrvllgenkvcgltrgqdakaaydagaiygglifvatsprcvnveqaqevm
    aaaplqyvgvfrnhdiadvvdkakvlslaavqlhgneeqlyidtlrealpahvaiwkals
    vgetlparefqhvdkyvldngqggsgqrfdwsllngqslgnvllagglgadncveaaqtg
    cagldfnsavesqpgikdarllasvfqtlray