PDB entry 1pig

View 1pig on RCSB PDB site
Description: pig pancreatic alpha-amylase complexed with the oligosaccharide v-1532
Class: glycosyltransferase
Keywords: alpha-amylase alpha-1, 4-glucan-4-glucanohydrolase glycosyltransferase
Deposited on 1996-06-15, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (1-495)
      • conflict (48)
      • conflict (242)
      • conflict (309)
      • conflict (403)
      • conflict (450)
      • conflict (483)
    Domains in SCOPe 2.07: d1piga1, d1piga2
  • Heterogens: HMC, BGC, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pigA (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsctgikvyvssdgtaqfsis
    nsaqdpfiaihaeskl