PDB entry 1pie

View 1pie on RCSB PDB site
Description: Crystal Structure of Lactococcus lactis Galactokinase Complexed with Galactose
Class: transferase
Keywords: galactose, galactosemia, kinase
Deposited on 2003-05-30, released 2003-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-11-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactokinase
    Species: Lactococcus lactis
    Gene: GALK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R7D7
      • cloning artifact (216)
      • cloning artifact (386)
    Domains in SCOP 1.75: d1piea1, d1piea2
  • Heterogens: GLA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pieA (A:)
    mgsshhhhhhssglvprgshmsivvenstvlsaltekfaevfgdtkeveyffspgrinli
    gehtdynggyvfpasitigttglarlredkkvklysenfpklgviefdldevekkdgelw
    snyvkgmivmlkgagyeidkgfellikgeiptasglsssaslellvgvvlddlfnlnvpr
    lelvqlgqktendyigvnsgildqfaigfgevkkaieldcntlkyemvpvelrdydivim
    ntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligdetlikra
    rhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaetaqkqagv
    lgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgstkldve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pieA (A:)
    tvlsaltekfaevfgdtkeveyffspgrinligehtdynggyvfpasitigttglarlre
    dkkvklysenfpklgviefdldevekkdgelwsnyvkgmivmlkgagyeidkgfellikg
    eiptasglsssaslellvgvvlddlfnlnvprlelvqlgqktendyigvnsgildqfaig
    fgevkkaieldcntlkyemvpvelrdydivimntnkpralteskynerfaetrealkrmq
    trldiqslgelsneefdantdligdetlikrarhavyennrtkiaqkafvagnltkfgel
    lnashaslkddyevtgleldtlaetaqkqagvlgarmtgagfggcaialvahdnvsafrk
    avgqvyeevvgypasfyvaqigsgstkl