PDB entry 1pie

View 1pie on RCSB PDB site
Description: crystal structure of lactococcus lactis galactokinase complexed with galactose
Deposited on 2003-05-30, released 2003-09-23
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pieA (A:)
    mgsshhhhhhssglvprgshmsivvenstvlsaltekfaevfgdtkeveyffspgrinli
    gehtdynggyvfpasitigttglarlredkkvklysenfpklgviefdldevekkdgelw
    snyvkgmivmlkgagyeidkgfellikgeiptasglsssaslellvgvvlddlfnlnvpr
    lelvqlgqktendyigvnsgildqfaigfgevkkaieldcntlkyemvpvelrdydivim
    ntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligdetlikra
    rhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaetaqkqagv
    lgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgstkldve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pieA (A:)
    tvlsaltekfaevfgdtkeveyffspgrinligehtdynggyvfpasitigttglarlre
    dkkvklysenfpklgviefdldevekkdgelwsnyvkgmivmlkgagyeidkgfellikg
    eiptasglsssaslellvgvvlddlfnlnvprlelvqlgqktendyigvnsgildqfaig
    fgevkkaieldcntlkyemvpvelrdydivimntnkpralteskynerfaetrealkrmq
    trldiqslgelsneefdantdligdetlikrarhavyennrtkiaqkafvagnltkfgel
    lnashaslkddyevtgleldtlaetaqkqagvlgarmtgagfggcaialvahdnvsafrk
    avgqvyeevvgypasfyvaqigsgstkl