PDB entry 1pi2

View 1pi2 on RCSB PDB site
Description: reactive sites of an anticarcinogenic bowman-birk proteinase inhibitor are similar to other trypsin inhibitors
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor
Deposited on 1991-03-26, released 1992-04-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bowman-birk inhibitor (pi-II)
  Species: Glycine max [TaxId:3847]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01064 (Start-62)
    • conflict (26)
  Domains in SCOPe 2.03: d1pi2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1pi2A (A:)
  deyskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpc
  ksr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1pi2A (A:)
  yskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpcks
  r