PDB entry 1pi2

View 1pi2 on RCSB PDB site
Description: reactive sites of an anticarcinogenic bowman-birk proteinase inhibitor are similar to other trypsin inhibitors
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor
Deposited on 1991-03-26, released 1992-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bowman-birk inhibitor (pi-II)
    Species: Glycine max
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01064 (Start-62)
      • conflict (26)
    Domains in SCOP 1.75: d1pi2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pi2A (A:)
    deyskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpc
    ksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pi2A (A:)
    yskpccdlcmctrsmppqcscedrinschsdckscmctrsqpgqcrcldtndfcykpcks
    r