PDB entry 1pi1

View 1pi1 on RCSB PDB site
Description: Crystal structure of a human Mob1 protein; toward understanding Mob-regulated cell cycle pathways.
Class: cell cycle
Keywords: Mob1, mitotic exit network, mitosis, Dbf2, CELL CYCLE
Deposited on 2003-05-29, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mob1A
  Species: Homo sapiens [TaxId:9606]
  Gene: Mob1A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H8S9 (1-184)
    • initiating met (0)
  Domains in SCOPe 2.08: d1pi1a1, d1pi1a2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pi1A (A:)
  meatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagp
  ryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakti
  lkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqeliekl
  gskdr