PDB entry 1phr

View 1phr on RCSB PDB site
Description: the crystal structure of a low molecular phosphotyrosine protein phosphatase
Class: phosphotyrosine protein phosphatase
Keywords: phosphotyrosine protein phosphatase
Deposited on 1994-07-05, released 1995-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low molecular weight phosphotyrosine protein phosphotase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1phra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1phrA (A:)
    aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1phrA (A:)
    vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr