PDB entry 1phr

View 1phr on RCSB PDB site
Description: the crystal structure of a low molecular phosphotyrosine protein phosphatase
Deposited on 1994-07-05, released 1995-07-31
The last revision prior to the SCOP 1.57 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.167
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1phr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1phr_ (-)
vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr