PDB entry 1php

View 1php on RCSB PDB site
Description: structure of the ADP complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms
Class: kinase
Keywords: kinase
Deposited on 1994-04-12, released 1994-06-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.156
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoglycerate kinase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1phpa_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phpA (A:)
    mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
    grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
    pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
    alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
    dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
    elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
    gladkmdhistgggaslefmegkqlpgvvaledk