PDB entry 1php

View 1php on RCSB PDB site
Description: structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms
Deposited on 1994-04-12, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 1.65 Å
R-factor: 0.156
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1php__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1php_ (-)
    mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
    grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
    pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
    alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
    dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
    elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
    gladkmdhistgggaslefmegkqlpgvvaledk