PDB entry 1phk

View 1phk on RCSB PDB site
Description: two structures of the catalytic domain of phosphorylase, kinase: an active protein kinase complexed with nucleotide, substrate-analogue and product
Class: kinase
Keywords: glycogen metabolism, transferase, serine/threonine-protein, kinase, ATP-binding, calmodulin-binding
Deposited on 1996-03-15, released 1996-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylase kinase
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1phka_
  • Heterogens: MN, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1phkA (A:)
    trdaalpgshsthgfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsa
    eevqelreatlkevdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvt
    lseketrkimrallevicalhklnivhrdlkpenilldddmnikltdfgfscqldpgekl
    revcgtpsylapeiiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrm
    imsgnyqfgspewddysdtvkdlvsrflvvqpqkrytaeealahpffqqyvveevrhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1phkA (A:)
    fyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlkev
    dilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimrall
    evicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylapei
    iecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspewd
    dysdtvkdlvsrflvvqpqkrytaeealahpffqqyv