PDB entry 1phk

View 1phk on RCSB PDB site
Description: two structures of the catalytic domain of phosphorylase, kinase: an active protein kinase complexed with nucleotide, substrate-analogue and product
Deposited on 1996-03-15, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1phk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1phk_ (-)
    fyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlkev
    dilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimrall
    evicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylapei
    iecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspewd
    dysdtvkdlvsrflvvqpqkrytaeealahpffqqyv