PDB entry 1ph6

View 1ph6 on RCSB PDB site
Description: Crystal Structure of THE OXYTRICHA NOVA TELOMERE END-BINDING PROTEIN COMPLEXED WITH NONCOGNATE SSDNA GGGGTTTTGTGG
Class: DNA binding protein/DNA
Keywords: single strand DNA binding protein, protein DNA interactions, sequence specificity, noncognate, oligonucleotide and oligosaccharide binding fold, ob fold, telomeres, protein/DNA, DNA binding protein/DNA complex
Deposited on 2003-05-29, released 2003-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-56A AND MAC-56K AND MAC-56S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ph6a1, d1ph6a2, d1ph6a3
  • Chain 'B':
    Compound: Telomere-binding protein beta subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-41A AND MAC-41S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ph6b_
  • Chain 'D':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*tp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ph6A (A:)
    kyeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagda
    sdyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkr
    svtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytal
    nkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrir
    satydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavv
    ltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrkt
    kkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkn
    adarkkledsaelltkfnsyvdavverrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ph6A (A:)
    kyeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqdasdyat
    lvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqe
    innqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqa
    qkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatyd
    etstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvltevd
    kkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktkksss
    lkkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhknadarkkled
    saelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph6B (B:)
    pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
    vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
    rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
    givkasaskgdefsdfsfkegntatlkiadifvqekg
    

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.