PDB entry 1ph6

View 1ph6 on RCSB PDB site
Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgtgg
Deposited on 2003-05-29, released 2003-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ph6A (A:)
    kyeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagda
    sdyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkr
    svtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytal
    nkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrir
    satydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavv
    ltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrkt
    kkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkn
    adarkkledsaelltkfnsyvdavverrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ph6A (A:)
    kyeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqdasdyat
    lvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqe
    innqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqa
    qkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatyd
    etstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvltevd
    kkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktkksss
    lkkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhknadarkkled
    saelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph6B (B:)
    pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
    vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
    rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
    givkasaskgdefsdfsfkegntatlkiadifvqekg