PDB entry 1ph5

View 1ph5 on RCSB PDB site
Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssDNA ggggttttg(3dr)gg
Class: DNA binding protein/DNA
Keywords: SINGLE STRAND DNA BINDING PROTEIN, PROTEIN DNA INTERACTIONS, SEQUENCE SPECIFICITY, NONCOGNATE, OLIGONUCLEOTIDE AND OLIGOSACCHARIDE BINDING FOLD, OB FOLD, TELOMERES, PROTEIN/DNA, DNA binding protein/DNA COMPLEX
Deposited on 2003-05-29, released 2003-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-56A AND MAC-56K AND MAC-56S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ph5a1, d1ph5a2, d1ph5a3
  • Chain 'B':
    Compound: Telomere-binding protein beta subunit
    Species: Sterkiella nova [TaxId:200597]
    Gene: MAC-41A AND MAC-41S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ph5b_
  • Chain 'D':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*(3dr)p*gp*g)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph5A (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvl
    tevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktk
    kssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkna
    darkkledsaelltkfnsyvdavverrngfylikdtkli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph5B (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg
    

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.