PDB entry 1ph2

View 1ph2 on RCSB PDB site
Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssDNA ggggttttg
Class: DNA binding protein/DNA
Keywords: single strand DNA binding protein, protein DNA interactions, sequence specificity, noncognate, oligonucleotide and oligosaccharide binding fold, ob fold, telomeres, protein/DNA
Deposited on 2003-05-29, released 2003-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 2003-11-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Oxytricha nova
    Gene: MAC-56A AND MAC-56K AND MAC-56S
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ph2a1, d1ph2a2, d1ph2a3
  • Chain 'B':
    Compound: Telomere-binding protein beta subunit
    Species: Oxytricha nova
    Gene: MAC-41A AND MAC-41S
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ph2b_
  • Chain 'D':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*g)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*gp*t)-3'
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph2A (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvl
    tevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktk
    kssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhkna
    darkkledsaelltkfnsyvdavverrngfylikdtkli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ph2B (B:)
    qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
    nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
    lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
    ivkasaskgdefsdfsfkegntatlkiadifvqekg
    

  • Chain 'D':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.